FASTA files


LEE genes
>tr|B7UMC9|B7UMC9_ECO27 Predicted protein OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=E2348_C_3971 PE=4 SV=1
MKRKPLIAFFIAIFIMLTILILFPFNCTYKKSPQEHSLSFIKQLPNTVNLSSLTYNKEDD
FLYATQNSPAQLLKITKSGDIMDRAPLPFISDAETIEHIQGNIFAAVDEKTSELFFFTVT
KDMHISFRNKIQLEKFNKKNRGFEGLAWKADDRMLFVAKERRPSKIFIYQLSSDLLSVKQ
ATIPEALNDIRVNDISGLAFNNESLMILSDESRKLLKFNLTEMSFIEMLDLTKGNHSLTS
DLPQPEGIVTLPDESIYVASEPDILAKFVPNK

>tr|B7UMC8|B7UMC8_ECO27 EspG1 T3SS LEE-encoded effector [LEE-encoded effector EspG OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=espG PE=4 SV=1]
MILVAKLFITNQIGESLMINGLNNDSASLVLDAAMKVNSGFKKSWDEMSCAEKLLKVLSF
GLWNPTYSRSERQSFQELLTVLEPVYPLPNELGRVSARFSDGSSLRISVTNSESIEAEIR
TPDNEKITVLLESNEQNRLLQSLPIDRHMPYIQVHRALSEMDLTDTTSMRNLLGFTSKLS
TTLIPHNAQTDPLSGPTPFSSIFMDTCRGLGNAKLSLNGVDIPANAQMLLRDALGLKDTH
SSPSRNVIDHGISRHDAEQIARESSGSDNQKAEVVEFLCHPEAATAICSAFYQSFNVPAL
TLTHERISKASEYNAERSLDTPNACINISISQSSDGNIYVTSHTGVLIMAPEDRPNEMGM
LTNRTSYEVPQGVKCTIDEMVRALQPRYAASETYLQNT

>tr|B7UMC6|B7UMC6_ECO27 Ler T3SS Transcriptional activator of LEE operons [Transcription regulator Ler T3SS [OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=ler PE=4 SV=1]
MRRLFIMNMETNSHTTSPYIQLIEQIAVLQQEAKRLREQEVQSVIESIQKQITYYNITLQ
ELGYTNVPDDGLARRNSSKGVYYRNEEGQTWSGVGRQPRWLKEALLNGMKKEDFLVKDTE
EEIIPLKNI

>tr|B7UMC5|B7UMC5_ECO27 EscE(Orf2) T3SS [Component of T3SS OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=E2348_C_3967 PE=4 SV=1]
MITITELEDEIIKNKEAANVFIEKINDKKNEIHEKMKHPLDKVTYNEAKELLIACDAAIR
TIEIMRIRINNK

>tr|B7UMC4|B7UMC4_ECO27 CesAB T3SS chaperone of EspA [Component of T3SS OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=E2348_C_3966 PE=4 SV=1]
MSIVSQTRNKELLDKKIRSEIEAIKKIIAEFDVVKESVNELSEKAKTDPQAAEKLNKLIE
GYTYGEERKLYDSALSKIEKLIETLSPARSKSQSTMNQRNRNNRKIV

>tr|B7UMC3|B7UMC3_ECO27 Orf4/ L0051 T3SS [Component of T3SS OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=E2348_C_3965 PE=4 SV=1]
MTIFNKIDYNYYKLINYPIMMVHDEWLGDLTGVNQVSFRRLRETSSTRNQLNKILRQEIQ
DKISGVELSDINKEGFLYQSIGKIRLLALSSALFDIQCPDYIFSRLYRETLIREIGYQNV
KQLSFYWQGGQCKPEYGEERFCAELIKYGAGNLEWLFADNPLWTIVKYLLPKSGEIKPTH
INDLFLNRLNKILLPYETL

>tr|B7UMC2|B7UMC2_ECO27 escL ( orf5/L0050) T3SS [Component of T3SS OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=E2348_C_3964 PE=4 SV=1]
MIYFLTDLIKFYCLMKLYEFKNIEIDLVLTEDIIPEDKLQEIIQSDDIIKLARKKTYEHL
LRARRKSKELKIESRKKIARKMIAMRERIRKNNKIKLDKEVNQSIKWVKDIQAIELVLMQ
DIMNKVHLSLTNALHSLDTSSRINWDDLLNEVVRETLSNNNIVGAIKITKNPDIKLDPGE
ANNIQLINDANTPHNKIIIENEYIRITLDPLEQISILLNSFKDNYLSIIQE

>tr|B7UMC1|B7UMC1_ECO27 EscR T3SS inner membrane translocase subunit [T3SS structure protein EscR OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=escR PE=3 SV=1]
MSQLMTIGSQPIFLIIVFFLLSLLPIFVVIGTSFLKISIVLGILKNALGIQQVPPNMALT
SVSLILTMFIMSPIILQINDNISQEPINYTDSDFFQKVDEKILSPYRGFLEKNTEKDNVE
FFERAAQKKLGNETILKKDSLFILLPAFTMGQLEAAFKIGFLLYLPFIAIDLIISNILLA
LGMMMVSPVTISIPFKILLFILVGGWQKLFEFLLVVN

>tr|B7UMC0|B7UMC0_ECO27 EscS T3SS inner membrane translocase subunit [T3SS structure protein EscS OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=escS PE=4 SV=1]
MDTGYFVQLCVQTFWIIFILSLPTVIAASVIGIIISLVQAITQLQDQTLPFLLKIIAVFA
TLALTYHWMGTTIINFSSIIFEMIPKVNG

>tr|B7UMB9|B7UMB9_ECO27 EscT T3SS inner membrane translocase subunit [T3SS structure protein EscT OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=escT PE=3 SV=1]
MNEIMTVIVSSFYCILRPLGMFIILPIFSTGVLLSNFIRNSIMIAFTLPIIVENYTFSEK
LPSGIFQLTGIVLKEISIGFFIGLSFTILFWAIDAAGQIIDTLRGSTISSIFNPSISDSS
SITGVILYQFISVIFVIHGGIQSILDKLYLSYEILPLQADIAFNRALIDFLFSLWDSFIK
LMLSFSVPMIIGIFLCDMGFGFLNKTAPQLNVFTLSLPVKSLIAIFILLLVIHVFPDFIT
ANIHSDIIDRSLPSMINE

>tr|B7UMB8|B7UMB8_ECO27 EscU T3SS inner membrane translocase subunit with large cytoplasmic domain [T3SS structure protein EscU OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=escU PE=4 SV=1]
MSEKTEKPTPKKLRDLKKKGDVTKSEEVMAAVQSLILFSFFSLYGMSFFVDIVGLVNTTI
DSLNRPFLYAIREILGAVLNIFLLYILPISLIVFVGTVTTGVSQIGFIFAVEKIKPSAQK
ISVKNNLKNIFSVKSIFELLKSVFKLVIIVLIFYFMGHSYANEFANFTGLNAYQALVVVA
FFVFLLWKGVLFGYLLFSVFDFWFQKHEGLKKMKMSKDEVKREAKDTDGNPEIKGERRRL
HSEIQSGSLANNIKKSTVIVKNPTHIAICLYYKLGETPLPLVIETGKDAKALQIIKLAEL
YDIPVIEDIPLARSLYKNIHKGQYITEDFFEPVAQLIRIAIDLDY

>tr|B7UMB7|B7UMB7_ECO27 EtgA T3SS periplasmic transglycosylase [Predicted protein OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=E2348_C_3959 PE=4 SV=1]
MKKIILSIILISNYCNASDCFEITGKAYNIDPLILKAIAWNESKCKSGIKSKTNKNGTYD
IGIMQINSSHLDLLSKFNISEDDLLNNACINISVAGYILASNIKYRGNTWDAVGAYNAGY
FNTPNAVELRRQYAMKIYKTYNKLKNNEQIID

>tr|B7UMB6|B7UMB6_ECO27 GrlR T3SS Negative regulator of Ler Transcription [Negative regulator GrlR OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=grlR PE=4 SV=1]
MIMKDGIYSIIFISNEDSCGEGILIKNGNMITGGDIASVYQGVLSEDEDIILHVHRYNYE
IPSVLNIEQDYQLVIPKKVLSNDNNLTLHCHVRGNEKLFVDVYAKFIEPLIIKNTGMPQV
YLE

>tr|B7UMB5|B7UMB5_ECO27 GrlA T3SS positive regulator of Ler Transcription [Positive regulator GrlA OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=grlA PE=4 SV=1]
MESKNKNGDYVIPDSVKNYDGEPLYILVSLWCKLQEKWISRNDIAEAFGINLRRASFIIT
YISRRKEKISFRVRYVSYGNLHYKRLEIFIYDVNLEAVPIESPGSTGPKRKTYRVGNGIV
GQSNIWNEMILRRKKES

>tr|B7UMB4|B7UMB4_ECO27 CesD T3SS chaperone of EspD [Chaperone CesD OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=cesD PE=4 SV=1]
MSRKFSSLEDIYDFYQDGGTLASLTNLTQQDLNDLHSYAYTAYQSGDVITARNLFHLLTY
LEHWNYDYTLSLGLCHQRLSNHEDAQLCFARCATLVMQDPRASYYSGISYLLVGNKKMAK
KAFKACLMWCNEKEKYTTYKENIKKLLGNTE

>tr|B7UMB3|B7UMB3_ECO27 EscC T3SS outer membrane ring-structure secretin [T3SS structure protein EscC OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=escC PE=3 SV=1]
MKKISFFIFTALFCCSAQAAPSSLEKRLGKNEYFIITKSSPVRAILNDFAANYSIPVFIS
SSVNDDFSGEIKNEKPVKVLEKLSKLYHLTWYYDENILYIYKTNEISRSIITPTYLDIDS
LLKYLSDTISVNKNSCNVRKITTFNSIEVRGVPECIKYITSLSESLDKEAQSKAKNKDVV
KVFKLNYASATDITYKYRDQNVVVPGVVSILKTMASNGSLPSTGKGAVERSGNLFDNSVT
ISADPRLNAVVVKDREITMDIYQQLISELDIEQRQIEISVSIIDVDANDLQQLGVNWSGT
LNAGQGTIAFNSSTAQANISSSVISNASNFMIRVNALQQNSKAKILSQPSIITLNNMQAI
LDKNVTFYTKVSGEKVASLESITSGTLLRVTPRILDDSSNSLTGKRRERVRLLLDIQDGN
QSTNQSNAQDASSTLPEVQNSEMTTEATLSAGESLLLGGFIQDKESSSKDGIPLLSDIPV
IGSLFSSTVKQKHSVVRLFLIKATPIKSASSE

>tr|B7UMB2|B7UMB2_ECO27 SepD T3SS [Secretion switching protein SepD OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=sepD PE=4 SV=1]
MNNNNGIAKNDCDWLTALDFVKDVNGSPTHLTFYIYQKNAFLHDFGNYWVLYIELSGDFR
QIPTDTFIRLCNILAVSKEYKQMGIFLSNKKWYLCQIFHKDNNHRANMSKAIMQHTLASL
LDKQFDKLEQSSSSDTMMPPTHLFSDIGRIV

>tr|B7UMB1|B7UMB1_ECO27 EscJ T3SS basal body ring-structure assembly platform [T3SS structure protein EscJ OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=escJ PE=4 SV=1]
MKKHIKNLFLLAAICLTVACKEQLYTGLTEKEANQMQALLLSNDVNVSKEMDKSGNMTLS
VEKEDFVRAITILNNNGFPKKKFADIEVIFPPSQLVASPSQENAKINYLKEQDIERLLSK
IPGVIDCSVSLNVNNNESQPSSAAVLVISSPEVNLAPSVIQIKNLVKNSVDDLKLENISV
VIKSSSGQDG

>tr|B7UMB0|B7UMB0_ECO27 EscI(rOrf8) T3SS rod-like [Chaperone of T3SS Rorf8 OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=rorf8 PE=4 SV=1]
MDALCYCLSHEKRLTVNMNNINQSENINIQLNKASQTNVVDEHIPLASTPSAAGAAQFLD
QLLPKTAGVSSPEQVLIEEIKKRHLATMNTDLSFDALSAGGLSPEDVLTLQKNVLNANVN
VDVVSKLASLLSTSVTKLVSMQ

>tr|B7UMA9|B7UMA9_ECO27 EspZ(SepZ) T3SS LEE-encoded effector [LEE-encoded effector EspZ OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=espZ PE=4 SV=1]
MEAANLSPSGAVLPLAATINGNNPVDEKTGVMQSEGGTSRSVRILGGVLIGAGVLAAIGT
GIAAMCVDDPSQRLGLGIAAGVLGGVTTVAGGLAMKYA

>tr|B7UMA8|B7UMA8_ECO27 Mpc T3SS Multiple Control Protein transcriptional regulator of Ler [Regulator Mpc OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=mpc PE=4 SV=1]
MNLLVKRNVEEFLRLLGNDFYLFDNRVEIDFNGFSFFIEIIDNNVFVTFALEYNENAFFS
FFSALAPERTQGVIEHIFVYDNKLCLSCLLTNIDVFFLMNTFQQHVQIIERVRRMTS

>tr|B7UMA6|B7UMA6_ECO27 EscN T3SS peripheral ATPase subunit of inner membrane translocase [Translocator EscN OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=escN PE=4 SV=1]
MISEHDSVLEKYPRIQKVLNSTVPALSLNSSTRYEGKIINIGGTIIKARLPKARIGAFYK
IEPSQRLAEVIAIDEDEVFLLPFEHVSGMYCGQWLSYQGDEFKIRVGDALLGRLIDGIGR
PMESNIVAPYLPFERSLYAEPPDPLLRQVIDQPFILGVRAIDGLLTCGIGQRIGIFAGSG
VGKSTLLGMICNGASADIIVLALIGERGREVNEFLALLPQSTLSKCVLVVTTSDRPALER
MKAAFTATTIAEYFRDQGKNVLLMMDSVTRYARAARDVGLASGEPDVRGGFPPSVFSSLP
KLLERAGPAPKGSITAIYTVLLESDNVNDPIGDEVRSILDGHIVLTRELAEENHFPAIDI
GLSASRVMHNVVTSEHLRAAAECKKLIATYKNVELLIRIGEYTMGQDPEADKAIKNRKLI
QNFIQQSTKDISSYEKTIESLFKVVA

>tr|B7UMA5|B7UMA5_ECO27 Orf15 T3SS [Predicted protein OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=E2348_C_3947 PE=4 SV=1]
MLDRILSIRKSRANRLRESMAKINSQIKEVDGKLDDCEQSIKESIASKQAYCASLVNLDK
VSLYKYQIKNNAFDEQKQRLYEKKSSLSKEKRSLLDSQKRTKENLQHVNKSVEKLSFAIK
EHYFD

>tr|B7UMA4|B7UMA4_ECO27 Orf16 T3SS [Predicted protein OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=E2348_C_3946 PE=4 SV=1]
MTRVSLKRNLIEPVSFRPSDDWPQGEESFNDIFYHIKKRSPDTLFIRMASLWKRLFYSSG
RRRRYFEEGEHSFSILCGRLRGVVLTIKCSNGIIYLSIKISQNNRNHVFLYHKKDYVFDK
LKEIFPDEAIEFTIEYEN

>tr|B7UMA7|B7UMA7_ECO27 EscV T3SS Inner membrane translocase subunit [Translocator EscV OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=escV PE=4 SV=1]
MNKLLNIFKKAESYHDLILALFFFMAVMMMIIPLPTVVVDIIIAINISTALLLLMLSIYI
KNPLELTSFPTILLITTLMRLSLSVSTTRLILLHHDAGDIIYSFGNFVVGGNIVVGLVIF
TIITIVQFMVITKGAERVAEVSARFSLDGMPGKQMSIDGDMRAGVIDPLEAKVLRSRVQK
ESQFYGSMDGAMKFVKGDAIAGIIIVLVNLFGGVLIGMWQFDMPFSEALSLFSVLSVGDA
LVAQIPALIISVTAGVVVTRVPGESEKEENLAGDIVQQVSVNSRPFLISAALMLVMAIIP
GFPTLVFLFLAVCLLGIAWKLQKKRTFGAGNNKDAMGADLSNSQNISPGAEPLILNLSSN
IYSSDITQQIEVMRWNFFEESGIPLPKIIVNPVKNNDSAIEFLLYQESIYKDTLIDDTVY
FEAGHAEISFEFVQEKLSTNSIVYKTNKTNQQLAHLTGMDVYATTNDKITFLLKKLVLSN
AKEFIGVQETRYLMDIMERKYNELVKELQRQLGLSKIVDILQRLVEENVSIRDLRTIFET
LIFWSTKEKDVVILCEYVRIALRRHILGRYSVSGTLLNVWLIGSDIENELRESIRQTSSG
SYLNISPERTEQIIGFLKNIMNPTGNGVILTALDIRRYVKKMIEGSFPSVPVLSFQEVGN
NIELKVLGTVNDFRA

>tr|B7UMA3|B7UMA3_ECO27 SepQ(EscQ) T3SS C-ring-like component [T3SS structure protein SepQ OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=sepQ PE=4 SV=1]
MKPLSSQLNMKINDFYLPLLPVIGTGRLYITSEGHACHAYFREVSGHGIRFTLTYSGYEG
RFWISEEQFIQWCQELFPYSESRLIPEDMIKLMILWVMQTALPEGDVSVDDVQFTMLNKD
VYPVIENNNGENRLNVIILETTVQSLQHLINDNWQFVPHSNALFFDGYIVPGWTDYPVTE
LRVGDSLRLYHVDDSQERRCWIVINNPLATVKLSDNNLSVTDVLAADPLCTISSETVMNR
IYCVIGTVHIDIHMLRNVQKDDIIDSTGYHLFGGCQLVRNNTTIAYGSIIKINEDFYFTI
SVVCD

>tr|B7UMA2|B7UMA2_ECO27 EspH T3SS LEE-encoded effector [LEE-encoded effector EspH OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=espH PE=4 SV=1]
MSSSLSGITFTTSLTSHASWNKLTRTLHISNDDIVDELQLKARMQQRHHRVFAGIDDYSI
INFRGKDYAVRFIKDKDNYVYKVNKITQESGCFSRIFSFLYGGVTKALESKLNERHITPL
SSTWFPRTALEGFLTERGLSSLLRRVQSTEGVNPPENTTLNSLSGVTV

>tr|B7UMA1|B7UMA1_ECO27 CesF T3SS chaperone of EspF [Chaperone CesF OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=cesF PE=4 SV=1]
MNEQFCKDLAHTFGITLEEQTDALAFHDNDGHEWILECAPQSEILFFYCYLSTNEPDQIN
KILEINNNREMLGMFFLSLKDDKTFLNIAFPKNKIDITEFTNLMENGYLLKKEIIKLLSL

>tr|B7UMA0|B7UMA0_ECO27 Map T3SS LEE-encoded effector Mitochondrial associated protein [LEE-encoded effector Map OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=map PE=4 SV=1]
MFSPTAMVGRALAQAVTQTLRPAVTKAATQAGMAASGMRFTPMQSNLMINHGKLTTQLLQ
AVAKQTGSSDTQQWFKQEQITFLSRAVNKTVDDYCMSNNSAISKETKCRIFKEVESAIQQ
PLDMNCAQSSISHFLQSNKYFNQKVDEQCGKGVDPITRFNTQTKLIEQVSREIFEQNFST
AKISDIKALTEKAIADNVQDTRL

>tr|B7UM99|B7UM99_ECO27 Tir T3SS Translocated intimin receptor [Translocated intimin receptor Tir OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=tir PE=4 SV=1]
MPIGNLGNNVNGNHLIPPAPPLPSQTDGAARGGTGHLISSTGALGSRSLFSPLRNSMADS
VDSRDIPGLPTNPSRLAAATSETCLLGGFEVLHDKGPLDILNTQIGPSAFRVEVQADGTH
AAIGEKNGLEVSVTLSPQEWSSLQSIDTEGKNRFVFTGGRGGSGHPMVTVASDIAEARTK
ILAKLDPDNHGGRQPKDVDTRSVGVGSASGIDDGVVSETHTSTTNSSVRSDPKFWVSVGA
IAAGLAGLAATGIAQALALTPEPDDPTTTDPDQAANAAESATKDQLTQEAFKNPENQKVN
IDANGNAIPSGELKDDIVEQIAQQAKEAGEVARQQAVESNAQAQQRYEDQHARRQEELQL
SSGIGYGLSSALIVAGGIGAGVTTALHRRNQPAEQTTTTTTHTVVQQQTGGNTPAQGGTD
ATRAEDASLNRRDSQGSVASTHWSDSSSEVVNPYAEVGGARNSLSAHQPEEHIYDEVAAD
PGYSVIQNFSGSGPVTGRLIGTPGQGIQSTYALLANSGGLRLGMGGLTSGGESAVSSVNA
APTPGPVRFV

>sp|P21244|CEST_ECO27 CesT T3SS chaperone of Tir [Tir chaperone OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=cesT PE=1 SV=1]
MSSRSELLLDRFAEKIGVGSISFNENRLCSFAIDEIYYISLSDANDEYMMIYGVCGKFPT
DNPNFALEILNANLWFAENGGPYLCYESGAQSLLLALRFPLDDATPEKLENEIEVVVKSM
ENLYLVLHNQGITLENEHMKIEEISSSDNKHYYAGR

>sp|P19809|EAE_ECO27 Intimin T3SS outer membrane adhesin [Intimin OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=eae PE=1 SV=2]
MITHGFYARTRHKHKLKKTFIMLSAGLGLFFYVNQNSFANGENYFKLGSDSKLLTHNSYQ
NRLFYTLKTGETVADLSKSQDINLSTIWSLNKHLYSSESEMMKAAPGQQIILPLKKLPFE
YSALPLLGSAPLVAAGGVAGHTNKLTKMSPDVTKSNMTDDKALNYAAQQAASLGSQLQSR
SLNGDYAKDTALGIAGNQASSQLQAWLQHYGTAEVNLQSGNNFDGSSLDFLLPFYDSEKM
LAFGQVGARYIDSRFTANLGAGQRFFLPENMLGYNVFIDQDFSGDNTRLGIGGEYWRDYF
KSSVNGYFRMSGWHESYNKKDYDERPANGFDIRFNGYLPSYPALGAKLMYEQYYGDNVAL
FNSDKLQSNPGAATVGVNYTPIPLVTMGIDYRHGTGNENDLLYSMQFRYQFDKPWSQQIE
PQYVNELRTLSGSRYDLVQRNNNIILEYKKQDILSLNIPHDINGTERSTQKIQLIVKSKY
GLDRIVWDDSALRSQGGQIQHSGSQSAQDYQAILPAYVQGGSNVYKVTARAYDRNGNSSN
NVLLTITVLSNGQVVDQVGVTDFTADKTSAKADGTEAITYTATVKKNGVAQANVPVSFNI
VSGTAVLSANSANTNGSGKATVTLKSDKPGQVVVSAKTAEMTSALNANAVIFVDQTKASI
TEIKADKTTAVANGQDAITYTVKVMKGDKPVSNQEVTFTTTLGKLSNSTEKTDTNGYAKV
TLTSTTPGKSLVSARVSDVAVDVKAPEVEFFTTLTIDDGNIEIVGTGVKGKLPTVWLQYG
QVNLKASGGNGKYTWRSANPAIASVDASSGQVTLKEKGTTTISVISSDNQTATYTIATPN
SLIVPNMSKRVTYNDAVNTCKNFGGKLPSSQNELENVFKAWGAANKYEYYKSSQTIISWV
QQTAQDAKSGVASTYDLVKQNPLNNIKASESNAYATCVK

>tr|B7UM96|B7UM96_ECO27 EscD T3SS outer membrane needle complex subunit [T3SS structure protein EscD OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=escD PE=4 SV=1]
MLSSYKIKLLNGAMRNRELQLPMGNLTLGTEDNDIVYFPLEQGLNQFLLDIREEGVFLLS
PVEFWIDGQPTPYEADKPLPVGKIIDIAGCCFIIGDIDHSLPLSDVPERFSAKNQRKKRL
ILASVIGATFALSGAIGSYVLLSPKAEPPTFTRADVYQQLKENKLHAITLVWHGKNIALY
GRCESTTDLTPFFNYLKEKNIFYYNKIICNNQIISAINDVLTEYGYKDIIITKGNKPGFF
LLSGYIPPSPKWSEVENLLLNTPGVAGWEIHNNSNNKINELASEFKKNKLINYVNIFKKN
DVIIVAGEVSQQNESKILAIINAMNKNSNVKILFQNIQPYISADIFPGKILRISGTMKNP
TIALDNGTSLGIGSILKGGYVIDAIDPKDGINISRPDEYIHIPLSY

>tr|B7UM95|B7UM95_ECO27 SepL T3SS [Secretion switching protein SpeL OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=speL PE=4 SV=1]
MANGIEFNQNPASVFNSNSLDFELESQQLTQKNSSNTSSPLINLQNELAMITSSSLSETI
EGLSLGYRKGSARKEEEGTTIEKLLNEMQELLTLTDSDKIKELSLKNSGLLEQHDPTLAM
FGNMPKGEIVALISSLLQSKFVKIELKKKYAKLLLDLLGEDDWELALLSWLGVGELNQEG
IQKIKKLYEKAKDEDSENGASLLDWFMEIKDLPEREKHLKVIIRALSFDLSYMSSFEDKV
RTSSIISDLCRIIIFLSLNNYTDIIAISIKKDKDVILNEMLSIIEHVWLTEDWLLESPSR
VSIVEDKHVYYFHLLKEFFASLPDACFIDNEQRSNTLLMIGKVIDYKEDVM

>tr|B7UM94|B7UM94_ECO27 EspA T3SS needle sheath-like filament/host cell membrane translator [Translocon EspA OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=espA PE=4 SV=1]
MDTSTTASVASANASTSTSMAYDLGSMSKDDVIDLFNKLGVFQAAILMFAYMYQAQSDLS
IAKFADMNEASKESTTAQKMANLVDAKIADVQSSSDKNAKAQLPDEVISYINDPRNDITI
SGIDNINAQLGAGDLQTVKAAISAKANNLTTTVNNSQLEIQQMSNTLNLLTSARSDMQSL
QYRTISGISLGK

>tr|B7UM93|B7UM93_ECO27 EspD T3SS host cell membrane translator [Translocon EspD OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=espD PE=4 SV=1]
MLNVNNDIQSVRSGASAATATSGINQSEVTSALDLQLVKSTAPSASWTESTALPTPPAGH
SLVTPSAAEDVLSKLFGGISGEVTSRTEGTEPQRSTQNASSGYPYLSQVNNVDPQAMMMM
ATLLSLDASAQRVASMKNSNEIYADGQNKALDNKTLEFKKQLEEQQKAEEKAQKSKIVGQ
VFGWLGVAATAIAAIFNPALWAVVAISATAMALQTAVDVMGDDAPQALKTAAQAFGGLSL
AAGILTAGIGGVSSLISKVGDVANKVGSNIVKVVTTLADTFVDNVASKISAVANGLTTSS
RSIGTTVLNNDAAYYNVLSQVSAFAVENLTRQSEYLSQSAKAELEKATLELQNQANYIQS
ASQLMSDSARVNIRIVSGRV

>sp|Q05129|EAEB_ECO27 EspB T3SS host cell membrane translator/actin-binding effector [Protein eaeB OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=eaeB PE=3 SV=1]
MNTIDNNNAAIAVNSVLSSTTDSTSSTTTSTSSISSSLLTDGRVDISKLLLEVQKLLREM
VTTLQDYLQKQLAQSYDIQKAVFESQNKAIDEKKAGATAALIGGAISSVLGILGSFAAIN
SATKGASDVAQQAASTSAKSIGTVSEASTKALAKASEGIADAADDAAGAMQQTIATAAKA
ASRTSGITDDVATSAQKASQVAEEAADAAQELAQKAGLLSRFTAAAGRISGSTPFIVVTS
LAEGTKTLPTTISESVKSNHDINEQRAKSVENLQASNLDTYKQDVRRAQDDISSRLRDMT
TTARDLTDLINRMGQAARLAG

>tr|B7UM91|B7UM91_ECO27 CesD2 T3SS chaperone of EspD [Chaperone CesD2 OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=cesD2 PE=4 SV=1]
MVDTFNDEVFNYYLEQKGYTIQKEFLCGSAFFIGWRIETPFFSLAYRLDEQELILCSFEA
RNQTGLNGPVLSLTRLLEELYHHFSGIKKISAMKSKIGSDSERQKREELFNYFIRKGAVQ
QETEDGIWFVMNVNS

>tr|B7UM90|B7UM90_ECO27 EscF T3SS needle subunit [T3SS structure protein EscF OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=escF PE=4 SV=1]
MNLSEITQQMGEVGKTLSDSVPELLNSTDLVNDPEKMLELQFAVQQYSAYVNVESGMLKT
IKDLVSTISNRSF

>tr|B7UM89|B7UM89_ECO27 Orf29( CesA2/L0017) T3SS inner membrane translocase component/EspA chaperone[Component of T3SS OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=E2348_C_3931 PE=4 SV=1]
MVNDISANKILVWAAVAAANHKLPKYAEAILNVFPQIIPDKKDIAHLEFIILFGLNRKND
AIKALEGCMDDESSQLLYSLFHENVSGWVRGF

>tr|B7UM88|B7UM88_ECO27 EspF T3SS LEE-encoded effector [LEE-encoded effector EspF OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=espF PE=4 SV=1]
MLNGISNAASTLGRQLVGIASRVSSAGGTGFSVAPQAVRLTPVRVHSPFSPGSSNVNART
IFNVSSQVTSFTPSRPAPPPPTSGQASGASRPLPPIAQALKDHLAAYELSKASETVNFKP
TRPAPPPPTSGQASGASRPLPPIAQALKDHLAAYELSKASETVSFKPTRQAPPPPTSGQA
SGPGGLPPLAQALKDHLAAYEQSKKG

Non-LEE

>tr|B7UH72|B7UH72_ECO27 EspG2 T3SS Non-LEE secreted effector [T3SS secreted effector EspG homolog OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=E2348_C_2916 PE=4 SV=1]
MINGISQLRSIQSNSAQSNSALFALESVLDVSSYLENNWSDKPWAERILSYLGLSHCRSE
YKGDDRLLLDVLSILKPILPSSNEAGKVQASFSDGSRLTISVTKSELIEIAVTTPEGDEV
SIFPERNKQDCLLKSLPVALHMPYIKKHHSLPEIEVNGADGMRFLCNFAAKLSTAIVPYS
EKTNPLSGVSPLNSIYADTFRGLGNSDVSINGVSLSREAQQLLCHFIGLKDTGSSPPSNI
INNGIDYDQAVILVSKSHVGEEQKALLTAVLCQPEFVAAICSSFYQSFTVPAFLLMHERI
FLARQHFSEKSLVLPNAHFSINISNSSNGGLYVFNNVGTFIMAPGERGDVVGVFTMRTSY
EIPLGTRCEIPELVRVIKPIYSASEAYSRN

>tr|B7ULW8|B7ULW8_ECO27 EspJ T3SS non-LEE? secreted effector[T3SS secreted effector EspJ homolog OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=E2348_C_0723 PE=4 SV=1]
MPIIKNCLSSISNILRNEKTSYSLIKTEQTGKLLNRKITTTPTPAKLLSYRNADLIKENY
ITEKVLSIFNIKRDFVAVRIQSNQFTDLKNKTIQGHKDTVAKVIDWYNPQKNAFGIMMGT
PRRSADIAKEESRNALNFMIMEKDTFNEKILNSNANLQKKYGTTENSSWVSASVGSLLDK
GAKVYPDISCSLRLGEPFIITLPETVRLDVNIHPLKK

>tr|B7UI20|B7UI20_ECO27 EspL T3SS Non-LEE secreted effector [T3SS secreted effector EspL homolog OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=E2348_C_3230 PE=4 SV=1]
MPIINKSASNYVEYISKNNPPYLSKKRDASINLNGKVSDCNGEIIWCRHIASYWSEFFCS
NSGKIDYETFSSPQLLSKAIVIQENKGTNNIKGDVYFVENESWGSVIYNLFLQLEKENKS
HTSLEVHSPGHAMALGIKIKNDKENKFVINFYDPNQTATHKRVFFCTNNICDIINLTAYD
FLSEQCLKCYGLKEDTLSLFVDKTKSNDNNNVFIKKLPDNILQGVVINFAMGAGLREIIK
KVYNDTRFTDLTKSQMKILCESKNVNNVPGLLLALQNGHDNVIDEYGTLIKKSNLNKEEL
IHILSARTLDGTIPGLYQALQNGHAQAIKSYGNLVLDTIDKNIDLEYLLSAFKYEAHSSN
KYTPGLFSAFKNGHADAIKAYCDVLGNSNLTRGEIIRMLEARNYDGAPGLLLAYQNGDIN
TIQSFFDSLIMLDISKDFIEELLTAKHYDFTGLSLAISHRHDHVVKLYGKLFKKLDTSPY
KMSIILALAIDCERNNANIIIDSEYKSNKAVKEYVEILKEFNICPEKVAEYLSEFSGKHF
LDVYNYYSN

>tr|B7UR60|B7UR60_ECO27 NleA/EspI T3SS Non-LEE secreted effector [T3SS secreted effector NleA/EspI homolog OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=E2348_C_1442 PE=4 SV=1]
MNIQPIVTSGITTQNNRHHHAEQTSPTQIPQSELPNGCETGFVVHIPEDMQRHAPECGET
TALLSLIKDEGLLSGLDKYLAPHLEEGSAGKKALDMFGLFNVSQMALEIPSTVPGISGKY
GVQLNIVKPDIHPTSGNYFLQIFPLHDEIGINFKDLPGPLKNALSNSNIPTTVSTAASTI
ASATTSTVTTASKDPIPWFGLTAQVVRNHGVELPIVKTENGWKLVGETPLTPDGPKANYT
EEWVIRPGEADFKYGASPLQATLGLEFGAHFKWDLDNPNTKYAVLTNAAANALGAVGGFA
VSRFTGTDPMLSPHIGAMVGQAAGHAIQYNTPGLKPDTILWWAGTTLGLADLNKAEFGEA
RFTDYPRIWWHAREGAIFPNKADIEHATGADIRAMEEGVSVGQRHPNPEDVVINIESNNS
PHHNPSNYVDTVDIIQETRV

>tr|B7UNX3|B7UNX3_ECO27 NleB1 T3SS Non-LEE secreted effector [T3SS effector-like protein NleB homolog OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=E2348_C_1041 PE=4 SV=1]
MLSPIRTTFHNSVNIVQSSPCQTVSFAGKEYELKVIDEKTPILFQWFEPNPERYKKDEVP
IVNTKQHPYLDNVTNAARIESDRMIGIFVDGDFSVNQKTAFSKLERDFENVMIIYREDVD
FSMYDRKLSDIYHDIICEQRLRTEDKRDEYLLNLLEKELREISKAQDSLISMYAKKRNHA
WFDFFRNLALLKAGEIFRCTYNTKNHGISFGEGCIYLDMDMILTGKLGTIYAPDGISMHV
DRRNDSVNIENSAIIVNRSNHPALLEGLSFMHSKVDAHPYYDGLGKGVKKYFNFTPLHNY
NHFCDFIEFNHPNIIMNTSQYTCSSW

>tr|B7UI21|B7UI21_ECO27 NleB2 T3SS Non-LEE secreted effector [T3SS secreted effector NleB homolog OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=E2348_C_3231 PE=4 SV=1]
MLSSLNVLQSSFRGKTALSNSTLLQKVSFAGKEYSLEPIDERTPILFQWFEARPERYEKG
EVPILNTKEHPYLSNIINAAKIENERIIGVLVDGNFTYEQKKEFLNLENEHQNIKIIYRA
DVDFSMYDKKLSDIYLENIHKQESYPASERDNYLLGLLREELKNIPEGKDSLIESYAEKR
EHTWFDFFRNLAILKAGSLFTETGKTGCHNISPCSGCIYLDADMIITDKLGVLYAPDGIA
VHVDCNDEIKSLENGAIVVNRSNHPALLAGLDIMKSKVDAHPYYDGLGKGIKRHFNYSSL
HNYNAFCDFIEFKHENIIPNTSMYTSSSW

>tr|B7UNX4|B7UNX4_ECO27 NleC T3SS Non-LEE secreted effector [T3SS secreted effector NleC homolog OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=E2348_C_1042 PE=4 SV=1]
MKIPSLQSNFNFSAPAGYSAPIAPNRAENAYADYVLDIGKRIPLSAADLSNVYESVIRAV
HDSRSRLIDQHTVDMIGNTVLDALSRSQTFRDAVSYGIHNEKVHIGCIKYRNEYELNEES
SVKIDDIQSLTCNELYEYDVGQEPIFPICEAGENDNEEPYVSFSVAPDTDSYEMPSWQEG
LIHEIIHHVTGSSDPSGDSNIELGPTEILARRVAQELGWSVPDFKGYAEPEREAHLRLRN
LNALRQAAMRHEENERAFFERLGTISDRYEASPDFTEYSAVSNIGYGFIQQHDFPGLAIN
DNLQDANQIQLYHGAPYIFTFGDVDKHNQR

>tr|B7UNX6|B7UNX6_ECO27 NleD T3SS Non-LEE secreted effector [T3SS secreted effector NleD homolog OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=E2348_C_1044 PE=4 SV=1]
MRPTSLNLVLHQSSTSSSMSDTDIESLVKASSVQWIKNNPQLRFQGTDHNIYQQIEAALD
KIGSTETGRVLLNAIESISRLKSETVVIHLNSSRLGVMAHRDIDAENHRGTGSDFHCNLN
AVEYPCGEGISVVDFHATIVFHELLHVFHNLNGERLKVESSRPESQKYSPLLLEEARTVG
LGAFSEEVLSENKFREEIGMPRRTSYPHDSALIHDDNTVSLGFQQVRLHPLL

>tr|B7UP11|B7UP11_ECO27 NleE T3SS Non-LEE secreted effector [T3SS secreted effector NleE homolog with internal deletion of 56 aa OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=E2348_C_1080 PE=4 SV=1]
MINPVTNTQGVSPINTKHAEHVVKNIYPEIKHDYFNESPNIDDKKYISGKRPMGQFSVDS
LYNPDLHALCELPDICCKIFPKENNDFLYMVVVYRNDSPLGEQRTNRFIELYNIKRDIMQ
ELNYELPDLKAVKSEMIIAREMGEIFSYMPVEINSYMKYINNKFAKIE

>tr|B7UR63|B7UR63_ECO27 NleF T3SS Non-LEE secreted effector [T3SS secreted effector NleF homolog OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=E2348_C_1445 PE=4 SV=1]
MLPTSGSSANLYSWMYVSGRGNPSTPESVSELNHNHFLSPELQDKLDVMVSIYSCARNNN
ELEEIFQELSAFVSGLMDKRNSVFEVRNENTDEVVGALRAGMTIEDRDSYIRDLFFLHSL
KVKIEESRQGKEDSKCKVYNLLCPHHSSELYGDLRAMKCLVEGCSDDFNPFDIIRVPDLT
YNKGSLQCG

>tr|B7UNX2|B7UNX2_ECO27 NleI/NleG T3SS Non-LEE secreted effector [T3SS secreted effector NleI/NleG homolog OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=E2348_C_1040 PE=4 SV=1]
MPSLVSGIQSSSLSTGMQVLRAQMAASGGGEITVGGQTVSITYSETDGRFLASGGNNSLL
SGLLLTGLNGGPEALRDIMLRMVSGSGNTQSHGDIEGKISQYKFSVNTQSLQCPSEAVRC
PIILDKPEEGVFVKNSEDSLVCTLFDSVSFSHLVRDGGRHPLTREPITSSMIVSPEQCIYDQAKGNFVIKDK

>tr|B7ULW4|B7ULW4_ECO27 NleH1 T3SS Non-LEE secreted effector [T3SS secreted effector NleH homolog OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=E2348_C_0718 PE=4 SV=1]
MLSPSSVNLGCSWNSLTRNLTSPDSRILSSVRDAAASSDNGAQVKVGNRTYRVVVTDNKF
CVTRESHSGCFTNLLHRLGWPKGEISRKIEVMLNSSPVNRAMERGAVHSNRPDLPPVDYA
PPELPSVDYNSLPVPGYVIGKGGNAVVYEDAEDATKVLKMFTTSQSNEEVTNEVRCFNQY
YGAGSAEKIYGDNGDIIGIRMDKINGESLLNISSLPAQAEHAIYDMFDRLEQKGILFIDT
TETNVLYDRTRNEFNPIDISSYNISERSWSENQIMQSYHGGKQDLISVVLSKI

>tr|B7UR62|B7UR62_ECO27 NleH2 T3SS Non-LEE secreted effector [T3SS secreted effector NleH homolog OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=E2348_C_1444 PE=4 SV=1]
MLSPSSINLGCSWNSLTRNLTSPDNRVLSSVRDAAVHSDSGTQVTVGNRTYRVVVTDNKF
CVTRESHSGCFTNLLHRLGWPKGEISRKIEAMLNTSPVSTTIERGSVHSNRPDLPPVDYA
QPELPPADYTQSELPRVSNNKSPVPGNVIGKGGNAVVYEDMEDTTKVLKMFTISQSHEEV
TSEVRCFNQYYGSGSAEKIYNDNGNVIGIRMNKINGESLLDIPSLPAQAEQAIYDMFDRL
EKKGILFVDTTETNVLYDRMRNEFNPIDISSYNVSDISWSEHQVMQSYHGGKLDLISVVL
SKI